dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|119026032|ref|YP_909877.1| (Bifidobacterium adolescentis ATCC 15703)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment serine-threonine protein kinase pknA2 [Bifidobacterium adolescentis ATCC 15703]
Sequence length 732
Sequence
MKKESYRLAMSEAQHAPEGQVIEGRYRVVSRIADGGMATVYQAVDERLGRTVAIKIMHTQ
LAQGPQRDQFVERFHREARSAAAIANPHIVQVYDTGEFDGLDFLVMEYVHGVNLRYEMNQ
QVTFSVRETLRIVGETLDGLASAHRAGVVHRDIKPENILLNDRGHVQITDFGLAKAVSQA
TLSSTGMLLGTAAYLAPEMIQHNQATPQGDLYSVGIMAWEMLAGKVPFTADNPVTLVFKH
VHEDVPDITTACPGINAGVAAFLARLTARAVEDRPQDASVAFDELQQLQSNLTIDDWQYR
LSAVSPAANDAADTMPGDGTRQMPLPPAPPAPPVRQNDDRTRQFNPENPNKTTVMPAQQA
DPEATTRLALEKNDVPANNVPASPSNGPVSGGQPKRSGKRAPVIIAVVAAIVLACAGGGG
YAWWYFRGPGSYWTMPQPADLTCSDSEPCRISNIKWNAYEELLKFSNIEYEETEAFSDSV
KAGNVISTDPENVGSHVSKRHHQKVKVVVSKGIKQGTVPTDILDATSANGKDPINALKRA
GFDNIEQTPANDDAYSMDVPQGALLDLSVDPGATLPHNAKITVTLSQGPKPVTMPDVVGK
SKDEAQQTLDALKLTVNWTEQFDDKIPQGQVISASAKTGDELHWGDSVNAVVSKGPETVT
LPNYVGQKAAAAKAALEKLGFSVKISSQLTLDSSQDKKVASQDPVGGTEVRLRQEDGTPN
TVTLKMYSSLFD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]