dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|124027547|ref|YP_001012867.1| (Hyperthermus butylicus DSM 5456)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Hbut_0666 [Hyperthermus butylicus DSM 5456]
Sequence length 301
Sequence
MANLAKYILSELERINAIVSEQLEHTKPLLEGAECIAAIGAGDSYAAALALEACSGGTAE
ALDPFDALYSGRLGRLARKGCILVALSVGGRTRAVLDVAQRYRELGGRVVAVTGPGTPLA
SLANDAVELVYTGLASGIGAARHVAMLAALAGLLGAQPQVANLDAPCELARADAYAGACE
AYSSAHYAELKRAEVWGEAAPSHRLEQLVHAPIYTAKTVAVYESSIASRDRQREALETLR
EAGFQVYTVPATGDCWSTILSQAAATLYCIAVRAENEKVEEPAYRRHPGLEHLTRLIYEM
S

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]