dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|124027706|ref|YP_001013026.1| (Hyperthermus butylicus DSM 5456)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycine cleavage system aminomethyltransferase T [Hyperthermus butylicus DSM 5456]
Sequence length 378
Sequence
MTGVKVPLYDVHRELGASLGEFAGWLVPIDYGSIVEEHVAVRKTVGFFDLSHMARIIVSG
PDAGKLLDKLVPRYLESEPGTMLGPTAFLNENAGFVDDVMLYNLGGNQWMIVANAVNREK
VLGWLNDWLSRLGFTASVEDKTLELAMFAVQGPKAAELMERLGAPREVLELKLLRFRLNV
ELSEAKARAFLVSRSGWTGEDGFEIIAPVGEAEKILRKAAEIVRELGGRLCGLGARDSLR
MEMGFVLYGHEIDEETTPVDARYWWVYQPGPKEDCVGCKALREALRRGAVKVRVGIRLSK
KARIVPRQGDKIYVEGVEVGHVTSGAYSPVLGRSIAQAYIKPSHALMGLTVEVERRGKRY
QGKIVDFPLVKPTSSPPL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]