dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|162451353|ref|YP_001613720.1| (Sorangium cellulosum 'So ce 56')

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment lactose operon repressor [Sorangium cellulosum So ce56]
Sequence length 386
Sequence
MDVDTISPRARLSLAPMDDNSPPEGRIKRGGRRAAVMVDVAKLAGVSYQTVSRVLHDSPH
VHRDTRERVLDAIRQLDYRPSSVAQALVTGRSRTLGVVSFDTTHYGPASTLHGLETAAHD
AGYGVSVVSLKSLSRAPVVDAVKGLCDQGADGIMVIAPLRSAVDALRHVSSDVPVVAVEG
GPDDSVPVVAVDQHGGATAATRHLLDLGHRAVWHIAGSTDSLEAEQRIDGWRSTLEAAGV
EPPPLLRGDWSARSGYELAPQLARTPGATAVFVANDQMALGVLRYLHEIGRAVPRDISIV
GFDDIPEAAYFTPPLTTVRQDFAELGRRCLHVLLGQIESGRRSCSRVVVEAELVLRKSTA
AVPGTDERSSLPAASARIPSRIRNPS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]