dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|163941382|ref|YP_001646266.1| (Bacillus weihenstephanensis KBAB4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence length 142
Sequence
MIGLRIKSLRKKENLTQKQLAEKIGVSQRMIGYYESEERFPPHDVLSKLADCFSVSADYL
LGRAVTDQPKEQLTQKDGKDIAKRMEEIKRDLQGEDGLMFSGEPMSEEAVESLLDAMEYI
VKQTKVINKKYVPKKYRSTDDN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]