dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|156937335|ref|YP_001435131.1| (Ignicoccus hospitalis KIN4/I)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment NADH-ubiquinone oxidoreductase, chain 49kDa [Ignicoccus hospitalis KIN4/I]
Sequence length 540
Sequence
MNFVGEVERKEWSNALYVEVEPQYWYENAARLKDQGYLFPSMLTAVDWPAEKKVQVFFLV
HRIRDASSVVLSTKVDRENRELPSLSSLYPGVEWHENETYEMFGINFTGHPDYERWGRIR
KLLLSEDPRLFPKDRFPLLKDSGGYKDLPKVNWAEIEGTDQEREGLREDLTYVYVGPQHP
ATHGPVGFLLGLKGEIVEDVIPRLGYVHRGVEWIYEQKEYLKVIPLLDRQCYIDGIGWEW
PYVMALEEIMDVKVDRRAQLLRILAAELSRIQSHLLYIGSFAENVNHLTAFAWTVRDREV
FINLLEMLTGQRMTFNYLRPGGVAFDLPQGFKDVYEKVVARFHKHFEKLIETTLDNPTVA
MRAEGVAQVSAEDAIKYGWSGPNLRASGVAWDLRINKPYGGYDDGIDFEGAVGSVGDNLD
RMLVRFEEIRQSLKIIRQVLRELTERGQNELGTHLKRVPPFPRKPGIAYGYHDSPRGENG
ILLVANPSDPKWRTRPWRVHMRSPVFVHTMSLKYLGKGLLLQDFLAFYISLDTCVAEMDR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]