dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|387790212|ref|YP_006255277.1| (Solitalea canadensis DSM 3403)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment trypsin-like serine protease with C-terminal PDZ domain [Solitalea canadensis DSM 3403]
Sequence length 588
Sequence
MLSCYLYLLSGVRFSSLNQFLVNYPLKMFFKKIFSFCCCLLIYLQGFGQEIRNAEQIEKL
TSRVVESTLSSCVQIAAYDTVRKRASTAVFSGVVVSAEGHILTVAHTTKPNQIYQIHFPN
GKKHLAIGLGRISIRNDSTDLDLAMIKLNGFESWSFTKMGQSAGLKANQPCVGISYPGTF
EKNMPNIRFGRLTNPKSKAGYIESTCKMEPGDSGGPLFNLNGEVIAIHSWIANGIDENFE
IPVDLYKKYWSALNSAIDYKEVPKADNATVSHLSSTVNTLLIPITDELASFPYHLKGSSV
LVTSNMEGHPQMIQGTVISYKSDQKRSIFIISKNSMVAENPVVQQNGKMFPVDVIWKDRD
NDLVLLRPSIRLKNGIELQKQSSSVELTQKDLGKILVSSTSHDNKRVGVLSSTYIEMPLR
FSRGYFGANATFINKKIVITQLASGSPAASVLKLDDQVTDINGVSIDQPIDYGSELMKYC
AGDSITVDIVRSGIPARFKIFLPPYPRQIKEAKQFGEVRSFRSDAFKKVLVWDADEKVEE
CGAPVFDTKGEFYGINIARHSRTSSIIMPVNFIIKLLENGIQNIEKQN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]