dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|159904743|ref|YP_001548405.1| (Methanococcus maripaludis C6)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphoribosylaminoimidazole-succinocarboxamide synthase [Methanococcus maripaludis C6]
Sequence length 245
Sequence
MLYDISKITAKEPIYVGKAKSIYTIEENEKEVLVEFRDDITAGNGAKHDVKFGKGYLNTV
ISNELFKVLEKNNVPTHLIEYIEPNHMIAKNVKIIPLEVIVRNIAAGSLCKKYPFEQGQV
LKTAVTQLDYKNDDYGDPMLNNEIAIELGLATEEELVEIKKLALKVNDVLKGFFDEKGII
LVDFKIEVGKTVDGDIVVADEISPDTMRLWDKETKDVLDKDVFRKDLGDVLEKYKIVAER
IGCLK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]