dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|226227433|ref|YP_002761539.1| (Gemmatimonas aurantiaca T-27)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GntR family transcriptional regulator [Gemmatimonas aurantiaca T-27]
Sequence length 256
Sequence
MSSARTSRRATAGAINQPPTTVSANEGGGRGASVGRAYDEIRELIVHGRLAPGSRIIESD
IAERLGLSRTPVRSALHRLQQEGYVAMIDRMKETRLIVAPLTQADALELFQMVGHLEGLA
ARTAAERPQEERTEIVTRLRMLNGHLATAGLAVPSDPRRLFDHDTAFHRAYVEAGAGPRL
QALHDAIKPQAERYARLYVNSLVDEIGKSVEEHELINRAIEMGDAAGAQSAVENNWRNAA
VRLARVIDSQGERGSW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]