dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|226229083|ref|YP_002763189.1| (Gemmatimonas aurantiaca T-27)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein GAU_3677 [Gemmatimonas aurantiaca T-27]
Sequence length 203
Sequence
MTKLDLKKDLRHLYAPSAKDVAVVDVPSMHFLMIDGEGDPNHAPAYAEAVEALFTLAYAI
KFAVKKGPAGIDYGVMPLEGLWWADDMSAFTTGDRSQWQWTMMIMQPDFVNASLVADITK
EVTRKKNPVALPLVRFEAFAEGPAAQVMHLGPFSEEGPTIERLHGFIEASGRQLAGKHHE
IYLSDIRKAAPDKWKTVVRQPLR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]