dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|294675872|ref|YP_003576487.1| (Rhodobacter capsulatus SB 1003)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L6 [Rhodobacter capsulatus SB 1003]
Sequence length 177
Sequence
MSRIGKKPVEMPKGVSATLSGQTIEVKGPKGTRSFTATDDVTVALDGSTVTVTPRGTSKR
ARQQWGMVRSMIENLAIGVSTGFKKELEIQGVGYRAAMQGNVLKLSLGYSHEVNFEAPAG
VTIATPKQTEITIEGIDQQLVGQVAANIREWRRPEPYKGKGIRYKGEFIFRKEGKKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]