dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|289192096|ref|YP_003458037.1| (Methanocaldococcus sp. FS406-22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment shikimate kinase [Methanocaldococcus sp. FS406-22]
Sequence length 282
Sequence
MEGRAYALASGTIINAIATGKGSAFGLNLKVYARVKLIDDGKNKIEGKVLDNPNIKPNLI
VRCVKNTLDYFGLNYSAYVETKTEIPIKSGLSSSSATSNAVVLATFDALGEKIDDELILN
LGIKSSFDEKLTVTGAYDDATASYYGGITITDNIKRKILKRDKMREDLNVLVLIPNLEKN
VDVNRMKLIKDYVEIAFNEAINGNYFKALFLNGILYASALNFPTKIAIDALEAGAITAGL
SGTGPSYIAIVEDENVEKVKEKLNRYGRVILTKPNNDGASIY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]