dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|161527901|ref|YP_001581727.1| (Nitrosopumilus maritimus SCM1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase S8/S53 subtilisin kexin sedolisin [Nitrosopumilus maritimus SCM1]
Sequence length 660
Sequence
MGLILTQATDSKNQIHTYLERSVPFVGTDIPRIDGIDGTGIKIAIIDTGVDFNHPDLFGW
GHDGKVVGGYNFIQEGQPPMDNNGHGTQVAGVIAADGQATGVAPKAKILAYKVSEDGEGV
SSDLIIRAIEKAIEDDADIINISLGVNKTNTKIERAVNQALEKEIFVVTAAGNDGPELGS
IGSPGRNFGSVTVGATYNNLTSSLVATLEVNDKPYTVIPMAGNKKTEDAISGKLVFGGFG
KVDELKDLDVKDSILIVERGSDVKEELLYFSIKETNAADAGAKAMIVYNNIPGIFLGELI
HEFIEPNYSPRIPVVSIDREEGLEIIESINGDEATLNLFFNPDYLAHFSSRGPVSPFYIK
PEIVAPGAYINTTQNNAGYNFTSGTSYAAPHVSGAAALLLQKNPELHHHEIKSLLLTTVE
PVSDAYGDEFSIQETGAGRLNIAKAFDAKLIIEPPNFVGLASSDNKVVEKQFQLKSLDGT
WDGFDMTFDGPEFIKFGGELVDENILNVKMRVLEDKFGEHEGKIKISHEGIQYVIPFVLH
YTQGSISIVQQNEKLFFEIHHPEEWSFAKISVTNSKDGRIDTTTVTPDKAASIDVYENAE
YWVDAKIRINGNTSSAYNTIEIKTLEERKRLDFDIPERQMVIIASAVIVIGIIGIVLKRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]