dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|157693540|ref|YP_001488002.1| (Bacillus pumilus SAFR-032)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sensor histidine kinase [Bacillus pumilus SAFR-032]
Sequence length 662
Sequence
MKFIQYFRKPSISKKLVLSFLFILLCPIIVLAFSSYHTASTSLNDQIMQSAKENVEQLDK
NITKVVKVKTDAADFFSKWITEKKLKQKGTTDIQGRFEQFMSMNDDTEGIFVASSDGKVF
SRYPNKKMPADYVATERDWYKDGWAKNGELSVSAPYPTASTGTLVVTISKKLEDGSGVIA
MNLDIANLVKESNSINIGKQGYAFIGSPDRTFVAHPTKKAGTKLSGEWLEKLYSQDEGSM
SYMFEGKEKQMEFTTNKATGWKIVGTMFVTEVEEAAQPVFNMAAIILAGALIIGGILIFL
IIRSITKPLSILVSSSKKISEGDLTEKIDVQSKDEIGQLGTSFNEMSESLRDVIQAVQTS
VENVASSSEELTASAGQTTKATEHITSSIETFSNGNENQSEMVEQSAAHLKQMNEGLNEV
AETSDVITASSIQSRTVAESGGQLVEQTVGQMKTIDHSVKEAEGVINGLEHKSKDITNIL
GVINGIADQTNLLALNAAIEAARAGESGRGFSVVAEEVRKLAVQSSDSAKEIEKLVKEIV
SEIETSQNMFKSVNEEVKNGLSITDQTKESFSQINQQTAEIATRINDMNTTVRELSKGSE
QISKAVNEIADVSRESSASIQDIAASAEEQLASMEEISSSSTTLSQMAEELRDLIKKFKI
NE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]