dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|157693543|ref|YP_001488005.1| (Bacillus pumilus SAFR-032)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment methyl-accepting chemotaxis protein [Bacillus pumilus SAFR-032]
Sequence length 663
Sequence
MKNALKWLKKPSISKRLIISFTLVLVLPIITLSTISYQIAKEELDHEIMYGANARVNELN
DMIQQKLVNKENAVKLFTETSSAADFKKNNQDELYEHFEIYSKINDEDVVGFYAASKKRD
FIQFPKVDMPKGYDPTTRDWYQLAMQDDSGNPVVTNPYISATTNGMVVTIAQRLKDGSGA
IGIDIDVQDIVDKIKEIKIGREGYPIIANKNKQIVAHPEEKSGSKVTENISSILYSGKEG
TSTYENKGEQKRLVFVTNDLTGWKIAGTMFVSETEEAAQPVWNSAIILLISSFILGGIAI
FFIVRSITIGLRKLVDFSEKVSEGDLTETLETKSKDEIGDLTRSFSKMSESLRDVIRAVQ
QSVDNVASASEELTASASQTSQATEHITMSIEQFSNGNDAQNEKVESSTNQLVAMNEGLQ
GMSQTSSEVASVSLQSTEAAGQGGRIVESTASQMKHIDTSVQEAEQVMKQLEFKSKDITS
ILNVINGIADQTNLLALNAAIEAARAGESGRGFSVVAEEVRKLAVQSADSAKEIEKLIQE
IVLEIAKSQDMFKTVNREVHAGLGMTEEAKESFQNIYEAAEGMSKKLTQLNDTAIDLSSG
SKLVSQAMQEMRQVSRESAANIQDIAASAEEQLASMEEISSSSVTLANMAEELKELTSQF
KID

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]