dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|159042105|ref|YP_001541357.1| (Caldivirga maquilingensis IC-167)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment histidine ammonia-lyase [Caldivirga maquilingensis IC-167]
Sequence length 497
Sequence
MTVEIGERINLVDVVNVARNHEEVKVSERALNLMNKSLDVLEKAVNSGIKIYGVNTGLGD
LHNVTVNPEDVARYSLEMLIDHSMGVGDYAPDDWVRATMLIRAHQLSLGYSGIRGRIIER
LIQFLNLNITPLVPKYGSVGASGDLAPLAHIALALLGKGLVKYRNEVMNSAEVFKALGLD
ELRLGYKEALSLINGTSYSAALASLGIWDAYTLIRAAMAIIILMIEASRASIRPLSIEVN
SIKLHYGEVEVARIIQESLSDSANVNTSGRVQDPYSIRCIPQVIGPIMDALSWSLRNIMN
EVNSVSDNPVIINDNVYSTCHFHGQYLALSTDLLNTSLSTLGNLLERQIAQLMRREINNT
SNYLANGPWRIGLMLTQYAAAALTARLRELASPSIIHNIPTSGLQEDVNSMSVNSAIKLH
EVNSLMKWLISLLAYVSYSVINANNGCVNCGKVSMHVYDIINRYVTGSQSHHEAVAKLTN
SINELASLINLKIDHLA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]