dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|158314975|ref|YP_001507483.1| (Frankia sp. EAN1pec)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment IS630 family transposase [Frankia sp. EAN1pec]
Sequence length 179
Sequence
MRYATGGGLTPAGQVERERVRLAAADRFAAGATRTEVAREFKVTPKTAGCWYRAWESGGA
AALRSTGPVSSCRLDDRDLARLEAILRRGPGVYGWTDQRWTLARVAQVIRREFGITYTVP
GVWMLLDRNGWSCQLPVRRAVERDDTVVEEWKDRGWPAVKPPRRPGVPGSVSSTRQGRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]