dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|158316957|ref|YP_001509465.1| (Frankia sp. EAN1pec)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment inositol-phosphate phosphatase [Frankia sp. EAN1pec]
Sequence length 304
Sequence
MSTVDAPPSTLRPAPAALLDLGLDVAREAGALLVTGRAGTVAAEATKSSPTDVVTALDRA
SEALVARRLREARPDDGLLGEEGSDTAGTSGVRWIVDPLDGTVNFLYRLPNWAVSIAAEL
DGEIVAGVVHAPAMGVTYTAVRGGGAFRWETPVGTDRGGDQGAGTGAGAPLGPTAGEPTK
LTGSAVTELGGALVATGFGYTERRRTTQAAVLTRVVPRVRDIRRMGAASLDLCAAAAGIV
DAYYERGLHPWDHAAGALIAAEAGLRVGGLDGREVSEDLVIAAPPSLFANLTALLAEHPR
ADTD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]