dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|158318184|ref|YP_001510692.1| (Frankia sp. EAN1pec)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence length 239
Sequence
MSVTYREYQPPAGLRPVVACTWEHESDEGHTQLVVPDGCMDLIWLSERELVIVGADTGPR
GVSLPGHARSSGIRLRCSAAGAVVGVPASELRDRQVDAASVWGEQAVGLQQALPVAAPAR
RLELLADAVGRRDARPDVLVAAAARRLAVPGARVADVAAELGVGERQLHRRTLAAVGYGP
KMLARVARLRRLVGLRDDSLSSRALRAGYASQAHMNDEVRRLTGSTPVRFLKDAALSAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]