dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|163868066|ref|YP_001609270.1| (Bartonella tribocorum CIP 105476)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment iron-responsive transcriptional regulator [Bartonella tribocorum CIP 105476]
Sequence length 144
Sequence
MRLTKQTNYALRMLMYCADNQGSLSRVSEIAKAYAVSELFLFKILQPLVQAGFIQTVRGR
NGGVKLAKPATEISVADVLKVTEDNFSLAECFDNAEPTCPLIDFCSLNIALQKALSAFFD
VLSVISLADLQRPSFHNHFKVNKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]