dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|158422353|ref|YP_001523645.1| (Azorhizobium caulinodans ORS 571)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment beta alanine--pyruvate transaminase [Azorhizobium caulinodans ORS 571]
Sequence length 467
Sequence
MCSGQFRCGGRATFQERTMDQVTDTGALARQLNVDPYWAPFTSNRRFKADPSDRTMISAE
GCYFTNANGVKLFDGSSGLWCTPLGHSHPRIVEAVTKQVRSLDYAPSFQVASATTIQLAE
RVAEMAPEGLNRVFFANSGSEAVDTALKIAMGYHRLTGNATRTRFIGREKGYHGVGFGGM
SVGGIVANRKMFAPGMVNGVDHLPHTYDQSKMAFSKGQPAWGAHLADELERIVALHDAST
IAAVIVEPMQGSAGVIVPPIGYLERLREICTKHGILLIFDEVITGFGRTGWAFAAQRLGV
VPDMITFAKAITNGIIPMGGVIARQEIYEAFMSGPPAAIEFCHGYTYSGHPMAAAAAHAT
LDVYEEEDLFGRVRALEPLMEAEFHSLKGEPNVVDVRNFGLTAAVELSPSAAGPSMRALS
IFEAGLKQGLYMRYTGESLAFSPPFISTEQQIKDMVAILRKLIRDAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]