dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|269955545|ref|YP_003325334.1| (Xylanimonas cellulosilytica DSM 15894)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphoribosylglycinamide formyltransferase [Xylanimonas cellulosilytica DSM 15894]
Sequence length 213
Sequence
MQTPSGHPVGSTSAARLVVLASGGGSNLAALLAAHDAPGYGARVVGLVTDKPTAGALDLA
RDAGIASAVVAPADFEDRAAWDRGVAEAVAVFRPDLVVLAGFMRILSPSFLDRFPGRVVN
THPALLPSFPGAHGVRDALAHGVRVTGCTVHVVDAGVDTGPILAQVAVPVLPDDDEASLH
ERIKVAERALLVETVGRIARDGLRVVDGRAVIG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]