dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|294101054|ref|YP_003552912.1| (Aminobacterium colombiense DSM 12261)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment biotin--acetyl-CoA-carboxylase ligase [Aminobacterium colombiense DSM 12261]
Sequence length 323
Sequence
MKKHIINILKQTQGTYVSGQDLCEQLGVSRTAVWKHINQLREEGYTIDSSARKGYRLIDV
PDLLNEYEVEPLLTTEVLGHPIIHFREVPSTNIEARKYAREGTAEGTVIVAEHQTAGRGR
SGRSWFSSPEWAIQMSLILRPKVSPALAASITQIGAAAVAKALESLGLSPQIKWPNDVLL
SEKKVCGILTEMSCELDHINHIVIGIGINVNTPHFPDDVASVATSVRIEKGETWNRKKLM
AAVLNSFEPLYKEFLEGKEHPEYLRICRALSNLIGQHITYETTKGRLSAKAIDIDNIGRL
IVQHSDGSTETLLSGEVHIGTQE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]