dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|294101302|ref|YP_003553160.1| (Aminobacterium colombiense DSM 12261)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase U62 modulator of DNA gyrase [Aminobacterium colombiense DSM 12261]
Sequence length 452
Sequence
MIVPDRDEVESYAELAIKEALEKGACGADILFYFGSSHSLSLRDEKPEQNNSGFSVGVGI
RTLDRDGRQGVAHINTFNRSSLQQLVEWSWHNCANLEPDPWTVLYNGKSSYAKNLELKDE
KISAILPEQRQEWCAEMTHLAKKKDSRVLSVRSASWNDGEGATFYMASTGVKGWYDGSGV
AAGLSLVMSDGVNMEMGGYGEDFRFLEDISLQRIVEKAVTQTACTLGGRPIQTKRYTLVL
SPEVSASLLSVIGELFCASNVHKNRSLYKGKLGKKVASPLLSLVDDGLMPRKLGTVPFDG
EGVPSQRTVLMKEGIVEGYLYNLKHAQKDGVESTGNAARSISSLPDVDISNFYMEPGNIS
SEEIFVSVQSGIYITEFLGLHTVNPVSGDFSLGIKGVSLSGGLFAQPVAGMTIAGNLLDL
LNRIVFIGNDLSFFGDTGGCTMVIDNVTAAGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]