dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|294101731|ref|YP_003553589.1| (Aminobacterium colombiense DSM 12261)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment DNA polymerase III subunit alpha [Aminobacterium colombiense DSM 12261]
Sequence length 1144
Sequence
MTTRPFVHLHVHSEYSLLDGAIRCGELAERVASWGMPAVALTDHGAMYGAIEFYDRCLAA
GIKPIVGCEVYVDPEGHTSREKKGRNFHLLLLAENQQGYNNLIKLVSIANTDGFYYRPRI
DYDLLTQYSQGIIASSACLAGEIPSLILQGKENDALAKAHMYRDIMGEDNFFLEIMYNAI
PEQAVVNRSLVQMARKNNFNLVATNDAHYLNKEDYDWHEILLCVQTGATINDPDRMSFST
NDFYLRSPEEMDSLFGAELPDALDNTLAIAERCSLKFDLGTRDYKLPSFDLPEGETLESN
LEKEAMAGLKQRLHKDNVPEEYKKRLDYELKVIKKMGFAGYFLIVASIIRAAKDRDIPIG
PGRGSAAGSLVAYSLRITELDPLKYNLLFERFLNPERVSMPDIDTDVSDKGREELLQYIA
EKYGVDRVAQIITFDRMKSKAAIRDVGRALGMPYSDVDVVAKLIPDGARSIPEALDQSED
LRNLTHKDLAVSRLLDSASKIEGLARHCSQHAAGVVITPMPITDLVPVRRIGENQIVTQF
PMEPLEKLGLVKMDFLGLKTLSVLEEAINNIKLNGKTPPDLNKIPLNDNLTYEMLQRGNT
LGVFQLESTGMRQLLRKIKPDCFEDLIAVLALYRPGPLGSGMVDQYIERKHGRAVVEYLH
PELSEVLKETYGVILYQEQVMQSAACLAGYSLGEADLLRRAMGKKKVEVMQQQRKMFADG
CAQHNVPARKAEEIFDIIQEFAGYGFNKSHSAAYALISYQTAYLKANFQPEFMAAYLTSQ
IGSKKDVMARYIREVRNSGIEVLPPDVNSSMESFAAVDEVVRFGLGAVAKAGHGAVEAII
AARECGGEFSSLWNFLCRVDLRVVNKSVIENLIKAGAFDGLNSNRRQLISALPDFVALAQ
RKGEEKNQCSLLSLLDEDSESGDLEPELPDIEDYAIYERLDMEKEVVGLYISGHPFTQHE
TLVSRYSTCSISNLKYWRSRNLFPQIGGMILSVHEKYTKRGDPMGILEVEDAESKLEVIC
FPKIWSSIKDQIEPGEICIIRGTLDERGSGNIIAKEIVSFQAIQGKMPPFVKIVLDGTLL
QPNSMKNFIRSLKDFPGRSQVLLEIRNGVGSVVILLSGIKVDGPTIKSKGLAPALPEEAY
EVFC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]