dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|294102499|ref|YP_003554357.1| (Aminobacterium colombiense DSM 12261)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GTP-sensing pleiotropic transcriptional repressor CodY [Aminobacterium colombiense DSM 12261]
Sequence length 261
Sequence
MKDLLDKTRQVGRALQSRREGTKPDYSKLAKLLCEFSTANVYIINREGRILVHSWVSEYH
SEAVANFLERGYMPESFVEKMNQHRESILSETDGYLFDDEVASKEAPEKHLLYVPIYSAA
ERLGTLLLVRFFNPFYMKDLILAEYLATLVGIEILHDRTRSIEERARERLVVQMAMRALS
YSEVESVKHIIAELGTYEGVVIASKVADRVGVTRSVIVNALRKLESAGIIESRSLGMKGT
FIKILSPLFIEELGMVLTQNN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]