dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSAPLP00000011982 (Anas platyrhynchos 76_1.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel scaffold:BGI_duck_1.0:KB742792.1:16282:22053:-1 gene:ENSAPLG00000012222 transcript:ENSAPLT00000012715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 89
Sequence
KVSICLECNSSKLRGLKRKWIRCSAQATVLHIKKFIAKKLNLSSFNELDILCNEEILVKD
HTLKFVVVTRWRFKKGIFLSHDEDELNLL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]