dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|284039585|ref|YP_003389515.1| (Spirosoma linguale DSM 74)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidoglycan glycosyltransferase [Spirosoma linguale DSM 74]
Sequence length 709
Sequence
MNIKQDIIQRANHVFYVVIFLAVCVVFRLVSVQYFKKDLKGRFWRERVAATLIQRDTIRA
MRGNIYAHDGYLLATSLPSYVVGLDPTMAKPDYFNKKVDSLGLLLSQLYGDRSRQDYTDM
IVDARKRKRRYVLLNRRRVTFQERQKMLTWPFFRSSAKVAARGGVLRPYYERYHPYGQMA
ERTIGNLDAKTGRGLIGLEASFQPALAGKNAVGLVEVLSGGIRKPVDDGPEMKPEPGMDL
YTTIDVNYQDMAESALRSTLEKYNAAKGCVVVMEVATGEIRAMANLSRVSSTTGPNRYVE
NFNHALAGRTDPGSTFKLATMMALMEEKAISLNQLVATGDGSTRYNGIEIRDASRTGKGT
ITAREVFEKSSNVGIHMLMRSYFYKRPDLYCQYLRKFHLTQPTGIHMKGEAIPVVRNPDM
KGWSKVSLTSMSYGYEMQITPLQMLAFYNAVANGGRWVRPVLVKQIKLADELIEDNKPYV
APDPICSKETARKAQELLRGVVEHGTAKHINNPFYAIAGKTGTAQKVINGKYQVGRYYTS
FIGYFPANNPKYSMITVVDNPEGDNIDMLYAGAVAAPVFKAVADRIVAYDYQMHAPIRVR
ASRPQSTTDVVAGYADDLHVIGSTLNMRNEPSTEGWVEATPRGGWKARPTRTDRVPDVRG
LTLRDALYLLENRGFRVLVDGRGKVKEQSVEPGTGIEKAAGKVITLTLG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]