dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|162147101|ref|YP_001601562.1| (Gluconacetobacter diazotrophicus PAl 5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein GDI_1306 [Gluconacetobacter diazotrophicus PAl 5]
Sequence length 247
Sequence
MTRISVELIPRDAEALLRDAAEVRQHFPLADTLNVPSLMRFPLRGWDAVPLLRPVLPRIV
PHIRAIDVDPAGPLPGVDVPGLEEVLVVQGDPPADLGHRTFPNSSESVIRRYRREAPHLR
VYAAFDPYRRAPYHELDAVARKKDAGATGFFTQPVFDPRMLDLCMEWLAGEAVFWGLSPV
IGPKSRSYWETTNHVVFPRDFEPTIEANIAFACRAIRTVRDAGGHVYLMPLRVKLERYLA
PIQQELG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]