dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|529226237|ref|YP_008387058.1| (Streptomyces collinus Tu 365)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein B446_17155 [Streptomyces collinus Tu 365]
Sequence length 251
Sequence
MSDGTPADLFFDAAIGLLQRVREEEAEAITAAGTLLADTVAAGGRLFAFGAGHSSLAAQD
VVYRAGGLALMNLLTVPGVVGVDVTPATLGSALERVDGLASAVLDTSPLRAGDTLVIISL
SGRNALPVEMALGARALGVKVVGVTSVAYATETSSRHSSGTFLRDHCDIVLDSKIAVGDA
ELTLDTIPAPFAPASTVVTSALMQAVMATAAAALADRGIEPPLLRSGNVDGGHDWNGRVM
TEYGDRIFYRH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]