dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|160895549|ref|YP_001561131.1| (Delftia acidovorans SPH-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment succinate-semialdehyde dehydrogenase [Delftia acidovorans SPH-1]
Sequence length 484
Sequence
MPLALRDPSLLKNLCLIDGQWLAADDGSRIDVHNPATGEAVGHVPRMGEAETQRAIAAAE
RAFALWKQQTAEARARLLQRWFELMMENQEDLALIMTSEQGKPLAESRGEIAYAASYVQW
FAEEARRIYGSTVPAPWADKRIIVTKEPVGVCAAITPWNFPAAMITRKVAPALAAGCTII
VKPAQQTPLSALAMAELAQRAGIPEGVFSVITGSSRAIGGVLTASMAVRKLTFTGSTEVG
RVLAEQCAPTLKKMSLELGGNAPFIVFDDADLDAAVEGAMASKYRNTGQTCVCANRLLVQ
DGVYDAFMARLKVAVQALKVGNGLEAGVGQGPLIDQAAVDKVEELVADAVKNGAEVVLGG
KRHALGGTFYEPTILANATDRMRIAREEVFGPVAPVFRFKTEEEAIRMANDTEYGLAAYF
YARDVGRVWRVGEALEYGMVGINSGIISTAVAPFGGVKQSGMGREGGAAGIEEYLSTKYL
CMGH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]