dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|163840763|ref|YP_001625168.1| (Renibacterium salmoninarum ATCC 33209)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment membrane protease regulatory membrane protein [Renibacterium salmoninarum ATCC 33209]
Sequence length 166
Sequence
MFEWLFENGWALWLIIFLALAVIEMLTLDLFFILMSVGALAAVVADLLGAPLWLQVIIFC
IVALAMILFVRPIALRHLHKGPNDLRTNVDRLIGHAAVVIEPVTSDGGRVKIGGDIWSAR
STNGAALAIGNNVEVTAIEGATAIVVAAAITPQSPHAEYPGTPAGA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]