dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|167033218|ref|YP_001668449.1| (Pseudomonas putida GB-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ferredoxin [Pseudomonas putida GB-1]
Sequence length 319
Sequence
MNEELLNVVVRKREIQGADVVVLDLGRADGAALPAFEAGAHVDIHVAPGLVRQYSLCSDP
ADVTVYRLGVLKDPASRGGSVGVHEALMEGREVQISAPRNLFPLAAGAARSILLGGGIGI
TPMIAMAHALHQQGADFELHYCGRSRSRSAFLEALADAPFAARVVTHFDDEEATQRLNLA
DVLGAGMPGTHLYTCGPSGFMDWVIAGARQQGYAEEHIHKEYFQVEVDATGQGFEVVAAR
SNKTVQVAEGQTILDALAQVGIRIDISCEQGVCGTCMCEVLEGEPDHRDVYLTDEEKAAN
DQILVCCSRAKSNKLVLDI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]