dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|172040327|ref|YP_001800041.1| (Corynebacterium urealyticum DSM 7109)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein cur_0647 [Corynebacterium urealyticum DSM 7109]
Sequence length 329
Sequence
MSITDPESVITVSATVIRDPHGRVLCVRKEGSPYFQLPGGKPEAGESSAQAATREAAEEI
GVELKEEDLSFLGIFSAQAANEKGFQVRSTVYTHPYTEALGQVAGGQAEIAETRWLDITT
PEELDEQLAPLLAQRIGPALGRRINSVTVFTGAKTGTGEEYVAQAREFGQPLADRGITLV
YGGGHVGLMGEIADGVLENGGHVVGVMPRHLVDEEIAHPGLSALLVVESMAERKQVMTDL
ADGFVALPGGVGTLDEVFEVWTGLQLGTHGKPVALCNSRFWQPLVTGLAAMVSEGFIRAA
DIDSLIVTEDAAETLERFEGWQPPRPRWS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]