dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|171058058|ref|YP_001790407.1| (Leptothrix cholodnii SP-6)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment LuxR family transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence length 267
Sequence
MPQPQSVERVPVEPEVSLQPQDIEALALNLDASLNVHTRSHFFTWTQGLLQGLIHHEALI
CVLRCPESATWRVDSFSTRVADSTVFAAPLLRDIALVPRLVDAWKGAHHLPIVLPARRDG
VLGSGAWVAELERIAATRLAVHGCHDIDGDANCLFLLACQGDSPDPRELCLLRLVVPFLR
EAWVRSQMIGGRHDDLPAPHGHAVITVREQEILKWIYLGKSNSEIGQILGISALTVKNHV
QKMLHKLNVVNRAQAVGRAIEAHLIQI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]