dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|171060807|ref|YP_001793156.1| (Leptothrix cholodnii SP-6)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment SARP family transcriptional regulator [Leptothrix cholodnii SP-6]
Sequence length 309
Sequence
MHTVVTAPATFSSALQDLPFAAGAAGQPHHQPELRPPPGGFVPRVVGYRDQTALAGTEAG
PTLTVQMLDGFQVWIGADPVTGLPQGKPRSLLKLLLLQRRRPLSRARLCALFWPDADAAS
ARNSLNVTLHRLRRALGHASLVRHGDAGYQLVAAGDVWLDTEQFLLHAEMGQLEDAQGRS
AGAIHQYEAALAIYRSDLLDEGDSDRALAAQAQALRDRLNQTLERLAVLREQAADWHGCL
RAALRHLGLDECNEAAHRRLMRCYARLGQPQLAERQYRACVTVLRLQLGLSPSDDTTALY
RRIAARTGD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]