dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|170741466|ref|YP_001770121.1| (Methylobacterium sp. 4-46)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment endoribonuclease L-PSP [Methylobacterium sp. 4-46]
Sequence length 126
Sequence
MRGRIDGGSPFEKAYGYSRAVVEGGFVFVSGTTGYDYAAMTMPEDAAAQAEACWRTIAAV
LEQAGASLERVVRATYYVTDRAEAEAVLAVCGRVMGAVRPAATLVVVAGLLRPEMKVEIE
VTALLP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]