dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|170290967|ref|YP_001737783.1| (Candidatus Korarchaeum cryptofilum OPF8)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment adenylosuccinate lyase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence length 456
Sequence
MWVHPIDSRYGSELMRAIFRQENRIKLMARVEALYARALAERGFIPKEAAEAIERAAEEV
TPEDVRAEEALVKHETMALVRAISKRAGRYGEYLHLGLTSNDVLDTVMGVQIRQAGSIIL
RSSASLLEKIVKRGEESLDIVCLGRTHGVVADPIPLSMKFALWSYYVRRSIARFMDSLNE
ASVGKLRGAVGTAAASIELGIKDPLEVESEVLAALGLSPPEITTQVVPRDRLAHLILSMS
LFSSALDTIANEIRNLHRTEISEVKEHFEERQVGSSTMPHKMNPINSEKVCGLARLMRSL
AIAALENVVLEHERDLTNSSVERAILPEAFLILEEQINTLSAVIENLEIDRVRIGENLEK
YGDIALSERLMIWLVKKGLGRQEAHEIVRSISLRSHRSGRRFIDEVLADESLSKILRPEE
IEAIFSPRSYLGLGRELSIEEFRAAREFLKEVLLNG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]