dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|479326600|ref|YP_007866657.1| (Sulfolobus islandicus LAL14/1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Mevalonate pyrophosphate decarboxylase [Sulfolobus islandicus LAL14/1]
Sequence length 325
Sequence
MLKSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLSDKNIVIVN
ERILPEDEMKEYAGRVLEAFKKIVGKEFNVKVESKAKFPVNAGLASSAAGIAALTFGLNE
LLELELKPEELSKIARVGSGSGCRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSELVD
IIPILSEKEKKISSRKGMIRSAETSELMECRLKFIEKTFNEVIEAIRNRDERKFYYLVMR
HSNSMHAIILDSWPSFFYLNDTSIRIMEWIQEYGKAGYTFDAGPNPHIFTTERYVQDILE
FLKSLEIKRIIVSKVGDGPKILNRE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]