dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|158339913|ref|YP_001521083.1| (Acaryochloris marina MBIC11017)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment endoribonuclease L-PSP [Acaryochloris marina MBIC11017]
Sequence length 135
Sequence
MAPSLTYLNPASLPDASAFGYSQITIMEPGRLAFISGQVAWQSSGEAVPDSLTGQAELVV
KNAKAALDAVGASSEDIVMVRIYMVDLTPDRIEELMPHLLAMFDGAKPSLTGVGVAALAG
PELQLEIEMIARLPS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]