dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|183220240|ref|YP_001838236.1| (Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)')

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment DNA mismatch repair protein MutS [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
Sequence length 833
Sequence
MNTPVMRQYLEVKELHPDGIVFFRMGDFYEMFLDDAKIAAQILDITLTKRQNQIPMAGIP
YHATESYISRLISAGKKVVVCEQTKPDDPKAKIMSREVVRIITPGTVVEDNLLGGYQNNY
LSLYYKEKTSVYLAFADVSTSELVYFFFSESEKERILDTIKRFSPKEMIYTDDIPPLSKE
SKIILTQIPKEYVPKKKGAGIDTVVHVLDAYLQYNYRNQNFVFKSPRRIDETEYLILDEQ
TVSHLELVENPNDKNHTLFGVLNRCLTATGKRYLKQRILFPTRDENKIKDHWDKIEILTQ
NKKERLKIKESLGDLIDLERVITRFRVGKALPRDFRGIEKSLTAVTLMKAVLDGIGYDFS
KLPNDLESLVLEFQNTLFDGELPVFLGNSPFLKSGFHKEYDEAILAREKGKDWILELEEK
EKKESGCSSLKIRYNKILGYFIEVSKAQAKDVPSHFLKKQTLVTGERFTSPKLEELERAI
LQADEIIERIEKQFFDRLVATCISLYEAFLTLSNEVASLDYHLSLTEIKEEYQWIRPEIR
NDGIIEYMDSRHPVVETFLPIGERFVPNHLELNPKENAIAVLTGPNMAGKSTFMRQIAIN
QILFQMGSYVPAKKASLSIVDRIFTRIGSGDNLTKGESTFYVEMRETATILNQFTENSLI
LFDEVGRGTSTYDGLSIAWAILEFLSKNFPKPKTIFATHYHELTELEKGAGIFNLYLDTF
EKDGEILFLKKVKRGKSKQSFGIYVAKLAGIPETVSERAKEILVGLESKKREIKIKNEEP
SLFGNILEKEPNGLSANEEKVIKRISQIDPNKIPPLEALSILDELKRILQEEN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]