dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|291613024|ref|YP_003523181.1| (Sideroxydans lithotrophicus ES-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment CheB methylesterase [Sideroxydans lithotrophicus ES-1]
Sequence length 189
Sequence
MGGKIVVVGSSTGGTEALKVFLSAMPEHAPAILIAQHMPELFTRSFAERLDHLCAVHVKE
AGHHEDIVAGHVYLAPGHSHLSLECVAGKYRTVLSRDPPVNRHRPSVEVLFHSAARCLGA
NAIGVMLTGMGKDGAAAMLEMKRAGAYNFAQDEASCVVFGMPREAIALGAVDEVLPLDRI
AERVLARVR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]