dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|295697577|ref|YP_003590815.1| (Kyrpidia tusciae DSM 2912)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase S58 DmpA [Kyrpidia tusciae DSM 2912]
Sequence length 330
Sequence
MRENGDGPGTTSDGVQRAAWFPLPGVRIGHAHDLRARTGCTVVLTPEGAAAGVDVRGSAP
GTRETDLLDPVNLVQEVHGVLLAGGSAFGLAAADGVMRYLEERGYGLDVGVGRVPIVPGA
VLFDLAVGDGSRRPDAVMGYAACEAAREVPERGRVGAGAGATVGKALGHLRAMDGGLGTA
AVQLPGGLVVAAVVAVNAVGHVVDPATGEILAGPLGEDGKPLDTLAVWNTGPGFGVLLPG
TNTTIGVVVTNARMSKVQAKKVATMAHDGLARVIRPAHTMYDGDALFALAVGGVTAPVDL
VGAWAAETVAAAVLDGVRQSASNGGAGRGD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]