dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|294506343|ref|YP_003570401.1| (Salinibacter ruber M8)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein SRM_00528 [Salinibacter ruber M8]
Sequence length 378
Sequence
MCVFNFVCSKRVLRPHGPCISVGPMTTLVRGKARRGNRRRAQGPNQPGCAVHGNSRSDMT
LLIASALLPLLILPGAALVWLTRRSPCRLLWGLKAAAVGGYVGLTYHLGSWYMLSTHGRY
VLLGLFAVGAGYGGWRMRHQVFWTRPRGWQWAGPGLAAVLLLLSVVGLRQRNQAREIPAP
PVNLTVPLRDGPVYVASGGSRSITNPHLKVDAPELQTWRGQRWGLDLVQLYPSGNRASGL
YPTALARYAVFGAPVYAPCDGVVETTAGSLPDRSPPARDTARKAGNHVLLRCAPDAYVLL
AHLKQGSVRVESGDSVSPDTRLGRVGNSGNSWEPHLHISAQDTVGTSALLDADPRPITFD
GRFPIRNDVVRTNGAGRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]