dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|294506928|ref|YP_003570986.1| (Salinibacter ruber M8)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Fe3+-siderophores ABC transporter [Salinibacter ruber M8]
Sequence length 268
Sequence
MPTATDARGHTVTLDHRPRQILSLVPSQTELLAHLDLADEVVGITRFCERPEHWRSEKAI
VGGTKQVDFDTVRDLDPDLVLANHEENTAEDVETLDEIAPVFVTEVKTVEDALGMIRTVG
TLTETSDQTSTLVGKIISRFESLPDFTSLRAAYLIWRDPYMTIGNDTFIHDVMHWGGLEN
AYGDQTRYPDVTIADLAEQDLDVVLCSSEPFPFHEKDAFTADLREALPDTSVEIVDGQPF
SWYGPRLLDTPSYLKTLRERLPTPAPRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]