dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|269122356|ref|YP_003310533.1| (Sebaldella termitidis ATCC 33386)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment lipoyltransferase and lipoate-protein ligase [Sebaldella termitidis ATCC 33386]
Sequence length 329
Sequence
MKYIINENNNPRYNLALEEYVLKNLDGEYFFLWQNEPTIVIGKHQNTISEINLDYVEKKG
IHVVRRMSGGGAVYHDLGNINFSFIQEKKDLADFDFSFFTRPIVDLLGELGIKAEFNSRN
DLAIDGKKFSGNAQYIFKKKILHHGTLLFNSEMEELVNSLKVSKDKIESKGLKSIKSRVA
NIKDYIGEDSKIKEVSDFKVALFEHMKNRMEEFEEYVLTENDKKEIEKLKKEKYDKWEWN
YGESPEADIHRQRKYTAGKVESYIKLKDGLIENIKLYGDFFSSREIEDLESGLKGKKYMI
SEIAEYLKTVNVSEYFSGFSEEEILDVII

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]