dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|271969381|ref|YP_003343577.1| (Streptosporangium roseum DSM 43021)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Subtilisin-like protein serine protease-like protein [Streptosporangium roseum DSM 43021]
Sequence length 1239
Sequence
MHWLARLTAAGAALSLALPALPSGAETASAPPPAAGLHRITLITGDVVTVRQAAAGKWAV
TVDPAKGREKVRFTTHDLDGKLQVLPDDMVPYVAENLVDKGLFAVGDLIEQGYDDAGSRT
LPLLLAYDKGARTSGALPGAKAGTELESIGARAVDAGKGELAAFWKAVEAAPSARSGGPR
LASGIRKIWLDAKVTADLEHSVPQIGAPDAWKSGFDGKGVKVAVLDTGADENHPDLAGKI
TDRRNFTADPSTQDGHGHGTHVATTVAGLGTASQGRRKGVAPGAELIIGKVLDSGGSGQF
SQIIEGMEWAAASGADVVNLSLGGEATDGTDPASAALNALTEQTGTLFVVAAGNEGREYA
VGTPGAATSALTVGAVGADETLAPFSSRGPRLDGGAKPDITAPGVAIVAARAEGTSMGQP
ADERYTAASGTSMATPHVAGAAAILKQRHPDWKAKQLKDALISTARTARDLTVYEQGGGR
VDVARAVRQDVTATGVLDLGTHQDGGSTAPSGTVAYTNSTQAAVSLALTATLSNLDGDAP
AQGALTLGSASITVDAGATVTVPVSADLAKLAHGRHSGHLTATTADGSVALQTTLALTRS
PRTHKVRISAVGKDGRPASVSTVFMFGPGTRDNLLTYIMPWEAEEGKTFEVPEGTYYAQS
QFGEERSGSRVIDIKIDIPEFPVTGDAELVFDARKTRPIVIKTPQPAVQEGISTFASYRD
TGTRKISSSFMNFPSVDELHVAETQPVRQGAFEFTSRWQYGAPRLSSRVSGLKGPLDLSP
TVRSPEWNGRYRWELVDGGHGTPEELGALKLRGRAVVMSSASQDDPQWDEMIAAAAEAGA
AAAVVVPAADDSPWQYWSPVMDRQAIPAAAIPYEQGKKLLERVRKGKAVLDVTGNMAIPY
LYDISQVSKGRIPEQIVYEANASNLARVDTGYHETGGFGWAKEQRFGWRPWQVFSNEGQR
WVRTGSARAEYVTSGDTEWEHVAQHMFTWESMRPLTPGLTGGLRSYAAGEKVGERWFGPV
VRPAVPPGRPESVPTRTGDTLRLDIPEFVDAAGHYGYAFSSDEEDTVSARFYRDGTLVEE
PRRAVGNFPAVPGKATYRMELSTKRSSEEWTYATETSTAWTFGSARPKSGSEPLPLLGVD
YTVPADLDGRVRRTLPVPLDFSVRSTAPGLALRQVTAELSYDDGKSWKRLVLLPRGKDRY
STLVSHQAGRGQYVSLRVTANDAAGNAVEQTVLRAYGVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]