dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428300288|ref|YP_007138594.1| (Calothrix parietina Calothrix sp. PCC 6303)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Cal6303_3698 [Calothrix sp. PCC 6303]
Sequence length 879
Sequence
MRKKLTWVVHHPRYRTLAVTAWMGTLLVLPLQVGELLISSPQVLAQPASAQLSEAQIKQL
AAAITVKVIAGENGGSGILIRKEAQKAGYLYTVVTNQHVLEPGKAAQIQTGDGKKYPATL
LKGVNFRGKDIALLQFSTNANYTVSSLGNLSTVTVNEPIYSAGFPFEKKANQNPFVFKSG
KVLLVPERAFKEGYQIGYDNTVEKGMSGGPILNRRGQVIGINGIHAYPLWGNPYVYEDGS
QPTAALKDLMSRYSWGIPIQTFAQLAPQYTSKESLPTGKTPVASKLPPIANDVSNIAKEI
TVLIDVPSMPQCSGSGVIISKQGNTYSVLSAEHVIRGSQKCDRTQLEIVTSDGKRYPIQV
NDRNVRSLPDSDLALLQFNSDQNYRTATLANYNITGYDGFIFVSGWQDTKAKNPALQHKF
TAGNVVSKQLGSSILAKNSLSSSYGYGMIYTNLTEQGMSGGPILDIRGRVIGIHGRSEVE
SVKDQAGKNRLITLGFSLGVPISDFINWSKSAGILSASKVETTIAPALTQPESDAILQSL
LQPVKPQNNADAIDWVNYGWELIRTSTSKTNTSESIQSFDKAIQLRPNFYQAWYLRGFVY
MTQNNYQESLKSFDKSVQIEPNFSTAWRWRGMILANLNKYQEALACFEQLAKLDPGDSGA
QTFRSIMLIGLQRFPEALEIAEKSLKQYPNSWNYFARGIARFGTKDQKGALADLNEAIRL
NPEAIEDTAYSVRATIRYAQGDIQGALTDYNEAIRLNPQKAEPILSRAAIHLQQKDYKSA
VVDLNEAIRLKPEYREAFELRGTLYFLQNKHQEAVKDLTQAIRLNSQNPDVYSIRGGAWL
QLKDKKAASLDFQKAADLYKQQGNNERYQQVLQAIKSLN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]