dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|169823732|ref|YP_001691343.1| (Finegoldia magna ATCC 29328)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cell wall-associated serine proteinase [Finegoldia magna ATCC 29328]
Sequence length 1960
Sequence
MKPYSKKFLAGVLLFSLALPSATTFATNQTDSTTYAKLQEQGVKADQEVKVIVETSDKTA
IEREPNVKSARFSKAVKASEAEVKKTSEKIETKLKKENVKVDKDDEFSAVITGFSAKVKA
KDIDKLRKQPGVKKVTTQMKAERPKVGASPSLASAPKMIKADTLWDSKYNFTGQGMLISI
IDTGVDPTHKDIQLESNDFQKYKSKEDVQKVIDANKLKGKWFSNKIPYGYNYADESQEIR
DSGIGGYHGMHVAGIVAANGNTETGGVRGVAPNAQLLAMKVFSNDALVSTVYEEVWLKAI
DDSVKLGADVLNMSLGMGSGYSREGVSPTNDAFKRAKKAGVVCAVAMGNDRVTNWGGEGK
TNLAINPDFGTTGHPAVADPSYSVASMENINMRGRVVEYKDNDKVVEIPTGTAEGENEKT
TTGMLPFVYVGKGNDQKKDYGDKVVKNKIVLAERGGASFNDKAELAASLGAKGIIIFNSK
DGSNLSFMSGMENKDFPSVFISHDDGLKLIELLKKPNQLINITKVQSVANPKAGQMSEFS
SWGITPDLRLKPDIAGVGGQIYSTINNNQYTMMSGTSMATPQVAGASALVMQRLYKDGLL
VRKDGKPDPRQEFLTVLVMMNTATPIKDTEVKGASYYTPKQQGAGLVNLKNVAETYVTVT
ATGGKDTKPDGKLELGEVGEDFKATFKLKNYSDKDITFTPKYISLKDEVKDGRYTEHSSE
VKKETLPKVTVKAKSEVTYTATISTDKIDKNQFAQGYVMFESDTDHPTLSVPYTGFKGNW
SQPQFLDNMPDFSDKVNYKPLVYDNGGIDKSGFMRRQEKGGWNYWNAWNVDGKPTVFVNS
NKQEGMNVEVAPVITIMRNALDVKYDILDKDGKTLRNLFIDPILLKVNGLYKGGDNQYRF
EYVPGGAAWDFKDSKGKPVEEGNYIYQITGHVDYKNAKEQKYQYNIVLDNTAPKLKGTYN
PEKGTITVTAHDDGSGVFSVGYENIKTGEWHEQQVREDHRYDDIGIVRDYSYEFKIADGF
DLANLSIYAWDNARNVDGKDVDTQVKSSDVQIDPIKIMVGDPVPTEEQVKKQIKAKVKDI
PENAEFKILRNIENTEKPGEFTIVVSVKNGEEQTNYTVPVKVEAIKPIELKVGDKPLITE
QVKAHLDFLPKDAKVRIVKNVDTKEPGEFGLKVEVKIDGKKIYYTIPVIVKAEEKKEEKP
EEKPEEKQEVKDQTVYNLPVIKVENPDYYAAFGKYEDEKNPDAYKKIHVKGNVTKIKQLD
HLTLTITKDGKKVEGTEVQEIKVNKEGDSNFSFDHELDISNLEDGSVYELQIKAEGENVR
GDGIQDTIIRRIRKDFVAPTVEYTVEHKDEKAPMAKIKVKGHENMTYLEMYLDGNMLSRV
DKTWDNFELKEGVDGEFEVEVPLEVGENKFQIKAYDDAGNETLQEVVINRKDPNEKDPVN
TKELADNMLKANSIVSVSEKYDVTDEQIAELKKLIEEAKTAITEQQPQDKVDAVNKKLTD
ALAKIKEKEVKKVDKKQLIGQKEDAQNLLDKKEVKLTDEQQKALQDLIKKAEDLTKKEDA
TQEEVDKLAKEIKDEIAKIQEAGKENPTKPGKEDPTKPGKEDPTKPGKEDPTKPGKEDPT
KPGKEDPTKPGKEDPTKPGKEDPTKPGKENPANPGTTTPSVPGTPTPAPKTPAQTTKATT
RVAGVDRINTAVEVSKKYYNSAETVIIANYEKFADSLSASALSKALKAPILLVQKDQLDS
VVAQEINRLGAKNVVVIGGDHSVDKAKNSLAKYNVQTIAGSDRYETSAKIAQEIIKRTGT
TQAVIASGETFADALTVAPLANKHNMPILLVQPNNIPKATQEVLKQINKVIIVGGEKTIS
NEVANKLPNPTRIAGANRYETAKKIYEYGFKDRKEVNIANGTNFADSLVIGSIDCPILLA
ESNEVPESTKQAIKDSKFEKVNVFGGENSIGESVVKELIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]