dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|171185634|ref|YP_001794553.1| (Thermoproteus neutrophilus V24Sta)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment anthranilate synthase [Pyrobaculum neutrophilum V24Sta]
Sequence length 422
Sequence
MKIPLSKLPPPRDLAHGLYQSGEEFVALLESGQGFAERARFTLVAWGVERAYVSSGPDLQ
QVLYSAQRELRADGGPFGGDVLIGALTYEASYYVEPLLLRYNKVDRSIPAAFLVKPRGYI
LYDKMLGRGYLRGEMPRVSVGRGEARVRGPVAMTDPGRFKSWVAEGRERIAAGEILQVVL
SRWVDYRAEGDLFPLYKALAEGNPSPYMYFVKYGDIHLIGTSPELLVKVQGGRVETHPIA
GTRPRGATEEEDLALEEDMLSDEKELAEHIMLVDLARNDIGRVCQLGSVKVEELFAVEKY
SRVQHIVSRVMGVMDRRFTPVDALLATHPAGTVSGAPKVRAMEIIAELEDEPRRFYAGAV
GFMSPSLLEFAIVIRTMVAVGDSLRIQAGAGVVYDSTPEREFRETESKLAALKAVVEGGP
WT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]